If you have been reading about creatine and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-04-18. Numbers and descriptions here follow the published literature rather than marketing material.
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
In solid form, creatine monohydrate is relatively stable when kept dry and away from heat. Moisture and elevated temperatures promote cyclization into creatinine, a related compound with no role in the phosphagen system. Degradation accelerates in aqueous solution, where the conversion can occur within hours to days depending on pH and temperature. Manufacturers typically recommend storage in sealed containers at room temperature, with relative humidity below 50 percent. Long-term stability data for opened containers are limited.
Analytical methods for creatine monohydrate focus on identity, purity, and degradation products. High-performance liquid chromatography with ultraviolet detection is common, often at a wavelength near 210 nanometers. Titration and nuclear magnetic resonance spectroscopy can also quantify the parent compound. Pharmacopeial monographs specify tests for appearance, solubility, water content, and related substances, including creatinine. Purity values above 99 percent are typical for pharmaceutical-grade material, though supplement-grade products vary. Independent verification can detect label discrepancies.
Sourcing and verification of creatine monohydrate involve both manufacturing origin and third-party testing. Industrial production commonly starts with sarcosine and cyanamide, followed by crystallization to obtain the monohydrate. Some products are derived from animal sources, while others are synthesized from non-animal precursors. Certificates of analysis report assay, heavy metals, and microbial limits. Regulations differ by country: in the United States it is sold as a dietary supplement, whereas in the European Union it falls under food supplement rules.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C4H9N3O2·H2O | Monohydrate includes one water molecule per creatine molecule |
| Molar mass | 149.15 g/mol | Value for the monohydrate; anhydrous creatine is about 131.13 g/mol |
| Appearance | White crystalline powder | Odorless or nearly odorless in purified form |
| Solubility in water | About 13 g/L at 25 °C | Solubility increases with temperature and varies with pH |
| Common synonyms | Creatine hydrate; N-(aminoiminomethyl)-N-methylglycine | Monohydrate distinguishes it from anhydrous creatine |
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
Handling practices aim to limit moisture uptake and thermal exposure. Containers should stay closed when not in use, and storage areas should avoid direct sunlight, strong heat, and high humidity. Caking can occur when powder absorbs water, even if the creatine itself has not fully degraded. Aqueous stock solutions are best prepared fresh when needed because they are less stable than the solid. Open questions include how different excipients, packaging materials, and climate conditions affect long-term stability across global supply chains.
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Quality control for creatine monohydrate typically combines identity, assay, and impurity tests. High-performance liquid chromatography with ultraviolet detection is common for separating creatine from creatinine and related substances. Nuclear magnetic resonance and infrared spectroscopy can confirm molecular structure, while titration may assess acid-base content. Moisture content, heavy metals, residual solvents, and microbial limits are checked according to applicable standards. These tests help distinguish compliant material from powders that have degraded, been diluted, or contain manufacturing residues.
Birds and bats have homologous limbs because they are both ultimately derived from terrestrial tetrapods, but their flight mechanisms are only analogous, so their wings are examples of functional convergence. The two groups have independently evolved their own means of powered flight. Their wings differ substantially in construction. The bat wing is a membrane stretched across four extremely elongated fingers and the legs. The airfoil of the bird wing is made of feathers, strongly attached to the forearm (the ulna) and the highly fused bones of the wrist and hand (the carpometacarpus), with only tiny remnants of two fingers remaining, each anchoring a single feather. So, while the wings of bats and birds are functionally convergent, they are not anatomically convergent. Birds and bats also share a high concentration of cerebrosides in the skin of their wings. This improves skin flexibility, a trait useful for flying animals; other mammals have a far lower concentration. The extinct pterosaurs independently evolved wings from their fore- and hindlimbs, while insects have wings that evolved separately from different organs. Flying squirrels and sugar gliders are much alike in their mammalian body plans, with gliding wings stretched between their limbs, but flying squirrels are placentals while sugar gliders are marsupials, widely separated within the mammal lineage from the placentals. Hummingbird hawk-moths and hummingbirds have evolved similar flight and feeding patterns.
Cetshwayo was captured a month after his defeat, and then exiled to Cape Town. The British passed rule of the Zulu kingdom onto 13 "kinglets", each with his own subkingdom. Conflict soon erupted between these subkingdoms, and in 1882, Cetshwayo was allowed to visit England. He had audiences with Queen Victoria and other famous personages before being allowed to return to Zululand to be reinstated as king. In 1883, Cetshwayo was put in place as king over a buffer reserve territory, much reduced from his original kingdom. Later that year, however, Cetshwayo was attacked at Ulundi by Zibhebhu, one of the 13 kinglets. Cetshwayo was wounded and fled. Cetshwayo died in February 1884, possibly poisoned. His son, Dinuzulu, then 15, inherited the throne. The academic Roberto Breschi notes that Zululand had a flag from 1884 to 1897 but this is pure conjecture as A.P. Burgers notes in his book. It consisted of three horizontal bands in equal width of gold, green and red.
== Rodlet self-assembly of class I hydrophobins == There is special interest in understanding the mechanism underlying class I monomers self-assembly that leads to formation of tough, ordered amphipathic rodlet monolayers, due to their intrinsic properties and due to substantial information available from several characterisation studies of the class I hydrophobins EAS and DewA. These mechanisms have been greatly studied by targeted mutagenesis in an effort to identify the key amino acid sequence regions driving rodlet self-assembly. A model for the monomeric form of EAS was proposed by Kwan et al. (2006) from structural data obtained from NMR spectroscopy and X-ray diffraction experiments that indicated the presence of four-stranded, antiparallel β-barrel core structure in EAS that allows monomer linking through backbone H-bonding. There are secondary elements around this β-barrel core like the Cys3-Cys4 and Cys7-Cys8 loops. This model is consistent with the amyloid-like structure that class I rodlets form, in which the β-strands are oriented perpendicular to the cross-β scaffold axis of the fibre. Site-directed mutagenesis of EAS has given insights into the specific structural changes responsible for self-assembly of monomers into rodlets and subsequent formation of amphipathic monolayer in hydrophobic:hydrophilic interfaces. Kwan et al.
Sources: en.wikipedia.org
Human anatomy (gr. ἀνατομία, "dissection", from ἀνά, "up", and τέμνειν, "cut") is primarily the scientific study of the morphology of the human body. Anatomy is subdivided into gross anatomy and microscopic anatomy. Gross anatomy (also called macroscopic anatomy, topographical anatomy, regional anatomy, or anthropotomy) is the study of anatomical structures that can be seen by the naked eye. Microscopic anatomy is the study of minute anatomical structures assisted with microscopes, which includes histology (the study of the organization of tissues), and cytology (the study of cells). Anatomy, human physiology (the study of function), and biochemistry (the study of the chemistry of living structures) are complementary basic medical sciences that are generally together (or in tandem) to students studying medical sciences. In some of its facets human anatomy is closely related to embryology, comparative anatomy and comparative embryology, through common roots in evolution; for example, much of the human body maintains the ancient segmental pattern that is present in all vertebrates with basic units being repeated, which is particularly obvious in the vertebral column and in the ribcage, and can be traced from very early embryos. The human body consists of biological systems, that consist of organs, that consist of tissues, that consist of cells and connective tissue. The history of anatomy has been characterized, over a long period of time, by a continually developing understanding of the functions of organs and structures of the body.
A diagnosis of rhabdomyolysis may be suspected in anyone who has sustained trauma, crush injury or prolonged immobilization, but it may also be identified at a later stage due to deteriorating kidney function (abnormally raised or increasing creatinine and urea levels, falling urine output) or reddish-brown discoloration of the urine. The most reliable test in the diagnosis of rhabdomyolysis is the level of creatine kinase (CK) in the blood. This enzyme is released by damaged muscle, and levels above 1000 U/L (5 times the upper limit of normal (ULN)) indicate rhabdomyolysis. More than 5000 U/L indicates severe disease, but depending on the extent of the rhabdomyolysis, concentrations up to 100000 U/l are not unusual. CK concentrations rise steadily for 12 hours after the original muscle injury, remain elevated for 1–3 days and then fall gradually. Initial and peak CK levels have a linear relationship with the risk of acute kidney failure: the higher the CK, the more likely it is that kidney damage will occur. There is no specific concentration of CK above which kidney impairment definitely occurs; concentrations below 20000 U/L are unlikely to be associated with a risk of kidney impairment, unless there are other contributing risk factors. Mild rises without kidney impairment are referred to as "hyperCKemia". Myoglobin has a short half-life, and is therefore less useful as a diagnostic test in the later stages. Its detection in blood or urine is associated with a higher risk of kidney impairment.
Deadlift – 400 kg (882 lb) (2005 Pojedynek Gigantów) Keg drop Deadlift – 295–350 kg (650–771 lb) x 6 lifts in 33.89 seconds (2005 World's Strongest Man) Keg drop Squat – 265–340 kg (584–750 lb) x 7 reps in 21.28 seconds (2007 World's Strongest Man - Group 4) Keg drop Squat – 260–360 kg (573–794 lb) x 7 reps in 27.53 seconds (2005 World's Strongest Man) (former world record) Log lift – 172 kg (379 lb) (2005 Met-Rx Grand Prix) Log lift (for reps) – 130 kg (287 lb) x 14 reps (2006 Moscow Grand Prix) Axle press (for reps) – 140 kg (309 lb) x 11 reps (2006 WSMC Poland) (World Record) Apollon wheel press – 166 kg (366 lb) x 4 reps (2004 Arnold Strongman Classic) Viking press – 150 kg (331 lb) x 12 reps (2007 Mohegan Sun Grand Prix) Kettlebell press – 80 kg (176 lb) x 8 reps (2009 Globe's Strongest Man) Atlas Stones – 5 stones weighing 115–155 kg (254–342 lb) on tall platforms in 21.09 seconds (2006 Strongman Super Series Moscow Grand Prix) (World Record) Ding carry – 160 kg (353 lb) for 90 metres (2005 World's Strongest Man) (World Record) Asia Stone / shield carry – 175 kg (386 lb) for 127.4 metres (2002 World's Strongest Man) (World Record) Africa Stone carry – 175 kg (386 lb) for 110 metres (2000 World's Strongest Man - Group 5) (World Record) Block carry – 180 kg (397 lb) for 80 metre course in 41.32 seconds (2002 Europe's Strongest Man) (World Record) Fridge carry (super yoke) – 410 kg (904 lb) for 20 metres in 15.29 seconds (2005 World's Strongest Man) Timber carry – 392 kg (864 lb) (40' ramp) in 22.93 seconds (Raw grip) (2006 Arnold Strongman Classic) Wheelbarrow carry (no straps) – 300 kg (661 lb) (25m course) in 15.50 seconds (2003 IFSA Finland Grand Prix) (World Record) Farmer's walk (no straps) – 150 kg (331 lb) per each hand for 60m course in 19.90 seconds (2006 Strongman Super Series Poland Grand Prix) (World Record) Farmer's walk (no straps) – 137.5 kg (303 lb) per each hand for 70m course in 22.48 seconds (2003 Strongman Super Series Finland Grand Prix) (World Record) Super Yoke – 360 kg (794 lb) for 20 meters in 7.66 seconds (2006 World Strongman Cup Federation, Poland) (World Record) Medicine Ball Toss – 23 kg (51 lb) for 4.88 meters (2004 Arnold Strongman Classic) Power Stairs – (225 kg (496 lb) total of 14 steps) – 40.94 seconds (2008 World's Strongest Man) (World Record) Power Stairs – (230 kg (507 lb) total of 23 shallow steps) – 26.33 seconds (2006 World's Strongest Man) (World Record) Power Stairs – (200 kg (441 lb), 230 kg (507 lb) & 250 kg (551 lb) total of 15 high steps) – 31.22 seconds (2004 Europe's Strongest Man) (World Record) Power Stairs – (225 kg (496 lb), 250 kg (551 lb) & 275 kg (606 lb) total of 15 steps) – 28.56 seconds (2005 Nautilus Grand Prix) (World Record) Tyre Flip – 380 kg (838 lb) Tyre x 8 flips - 20.81 seconds (2004 Holland Champions Trophy) and 400 kg (882 lb) Tyre x 8 flips - 22.87 seconds (2006 Moscow Grand Prix) (former world records) Flip & drag – 400 kg (882 lb) tyre x 4 flips and 300 kg (661 lb) anchor & chain drag for 30 meters – 39.01 seconds (2002 World's Strongest Man) (world record) Conan's wheel (Basque circle) – 360 kg (794 lb) 765° rotation (2006 World Strongman Cup Russia) (World Record) Conan's wheel (Basque circle) – 317.5 kg (700 lb) 1,203° rotation (2003 Strongman Super Series Holland Grand Prix) (World Record) Conan's wheel (Basque circle) – 300 kg (661 lb) 1,440° rotation (2002 World's Strongest Man - Group 5) (former world record) Train pull – 16,000 kg (35,274 lb) for 25 meter course in 30.78 seconds (2003 World's Strongest Man) (World Record) Truck pull – 24,000 kg (52,911 lb) for 20 meter course in 26.05 seconds (2003 IFSA Strongman World Record Breakers) (World Record) Plane pull – 40,000 kg (88,185 lb) for 25 meter course in 36.67 seconds (2008 World's Strongest Man) (World Record) During training: (Self-claims)
Sexual arousal can result from physical stimulation of the penis, typically combined with mental stimuli (sexual fantasy), partnered activity, or masturbation, and can lead to ejaculation. The glans and the frenulum are erogenous zones of the penis. The glans has many nerve endings, which makes it the most sensitive. The most effective ways to stimulate the penis are through oral stimulation (fellatio), manual stimulation (a handjob or manual masturbation), or during sexual penetration. Frotting is mutual penile stimulation by two men rubbing their penises together.
Sources: en.wikipedia.org
The first step in the NADP-ME type C4 pathway is the conversion of pyruvate (Pyr) to phosphoenolpyruvate (PEP), by the enzyme Pyruvate phosphate dikinase (PPDK). This reaction requires inorganic phosphate and ATP plus pyruvate, producing PEP, AMP, and inorganic pyrophosphate (PPi). The next step is the carboxylation of PEP by the PEP carboxylase enzyme (PEPC) producing oxaloacetate. Both of these steps occur in the mesophyll cells: pyruvate + Pi + ATP → PEP + AMP + PPi PEP + CO2 → oxaloacetate PEPC has a low KM for HCO−3 — and, hence, high affinity, and is not confounded by O2 thus it will work even at low concentrations of CO2. The product is usually converted to malate (M), which diffuses to the bundle-sheath cells surrounding a nearby vein. Here, it is decarboxylated by the NADP-malic enzyme (NADP-ME) to produce CO2 and pyruvate. The CO2 is fixed by RuBisCo to produce phosphoglycerate (PGA) while the pyruvate is transported back to the mesophyll cell, together with about half of the phosphoglycerate (PGA). This PGA is chemically reduced in the mesophyll and diffuses back to the bundle sheath where it enters the conversion phase of the Calvin cycle. For each CO2 molecule exported to the bundle sheath the malate shuttle transfers two electrons, and therefore reduces the demand of reducing power in the bundle sheath.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
CO2 + 4 H2S + O2 → CH2O + 4 S0 + 3 H2O CO2 + H2S + O2 + H2O → CH2O + SO2–4 + 2 H+ In modern oceans, Thiomicrospira, Halothiobacillus, and Beggiatoa are primary sulfur oxidizing bacteria, and form chemosynthetic symbioses with animal hosts. The host provides metabolic substrates (e.g., CO2, O2, H2O) to the symbiont while the symbiont generates organic carbon for sustaining the metabolic activities of the host. The produced sulfate usually combines with the leached calcium ions to form gypsum, which can form widespread deposits on near mid-ocean spreading centers. Sulfur metabolizing microbes are often engaged in close symbiotic relationships with other microbes, and even animals. PSB and sulfate reducers form microbial aggregates called “pink berries” in the salt marshes of Massachusetts within which sulfur cycling occurs through the direct exchange of sulfur species. The Vestimentiferan tube worms that grow around hydrothermal vents lack a digestive tract but contain specialized organelles called trophosomes within which autotrophic, sulfide oxidizing bacteria are housed. The tube worms provide the bacteria with sulfide and the bacteria shares the fixed carbon with the worms.
The rearrangements of heavy-chains are different from the light chains because DNA undergoes rearrangements of V-D-J gene segments in the heavy chains. These reorganizations of gene segments produce gene sequence from 5 prime to 3 prime ends such as a short leader exon, an intron, a joined VDJ segment, a second intron and several gene segments. The final product of the rearrangement is transcribed when RNA polymerase
== Nuclear fuel == Uranium-233 has been used as fuel in several reactor types and has been proposed for use in new designs. Uranium-233 can be bred in either fast reactors or thermal reactors, unlike the uranium-238-based fuel cycles which require the superior neutron economy of a fast reactor in order to breed plutonium, that is, to produce more fissile material than is consumed. In 1968, the Molten-Salt Reactor Experiment at Oak Ridge became the first reactor to operate on uranium-233. The long-term strategy of the nuclear power program of India, which has substantial thorium reserves, is to move to a nuclear program breeding uranium-233 from thorium feedstock.
Sources: en.wikipedia.org
It is a crystalline form of creatine that contains one water molecule per creatine molecule. The compound occurs naturally in muscle tissue and is also produced synthetically for research and consumer products. The monohydrate label describes the solid's hydration state.
Creatine monohydrate contains creatine, but the two terms are not strictly interchangeable. The monohydrate includes water in the crystal, while creatine refers to the base molecule. Other creatine forms pair the molecule with different acids or carriers.
Dietary creatine is found mainly in meat and fish. The human body also synthesizes creatine from amino acids in the liver, kidneys, and pancreas. The monohydrate powder used in products is manufactured rather than extracted directly from food.
Yes, especially when exposed to moisture or heat, where it converts to creatinine. In dry, sealed containers at room temperature, degradation is slow and the product may remain within specification for two to three years.