Phosphocreatine raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-02-11 and is reviewed periodically as new material appears.
Quality control of creatine monohydrate relies on a combination of identity, purity, and moisture tests. High-performance liquid chromatography with ultraviolet detection is widely used to separate creatine from creatinine and other related nitrogenous compounds. Spectroscopic methods such as infrared and nuclear magnetic resonance provide structural confirmation. Because the material is a hydrate, water content is measured separately, often by Karl Fischer titration. These tests together establish whether a lot meets a defined specification.
Manufacturing processes can leave trace amounts of dicyandiamide, creatinine, or residual solvents, depending on the synthetic route and purification steps. Heavy metals, arsenic, and microbial contamination are also monitored for food or pharmaceutical grades. Particle size distribution can affect dissolution behavior and blending uniformity, so it may be specified for certain applications. Analytical results are reported on a dry basis or as-is basis, and the difference matters when comparing certificates of analysis. Open questions remain about how minor impurities influence long-term stability under varied storage conditions.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine associates with one molecule of water in the solid lattice. Its molecular formula is C4H11N3O3, and its molar mass is about 149.15 grams per mole. The material appears as a white, odorless powder that dissolves sparingly in water at room temperature. The monohydrate designation distinguishes it from anhydrous creatine, which lacks the bound water and has a lower molar mass. This hydrate is the most common commercial form of creatine used in nutritional and research settings.
Creatine is synthesized endogenously in humans, mainly in the liver, kidney, and pancreas, from the amino acids arginine, glycine, and methionine. Skeletal muscle stores much of the body's creatine, where it participates in the phosphocreatine system that buffers adenosine triphosphate during short, intense contractions. Dietary sources include meat and fish, so omnivorous diets provide additional creatine beyond endogenous production. Supplemental creatine monohydrate supplies the same molecule found in food and tissues, not a distinct drug or hormone. Research interest centers on its role in cellular energy transfer and its effects on muscle and other tissues.
| Property | Value | Notes |
|---|---|---|
| Assay method | HPLC with UV detection | Commonly used for content and purity |
| Water content | Karl Fischer titration | Measures total water including hydration |
| Identity test | FTIR or NMR spectroscopy | Confirms chemical structure |
| Common impurities | Dicyandiamide, creatinine | Process-related or degradation markers |
| Storage condition | Dry, sealed, 15–25 °C | Protect from moisture and heat |
Analytical laboratories commonly identify creatine monohydrate by high-performance liquid chromatography with ultraviolet detection, often after dissolving the sample in water or dilute acid. Ion-exchange or reversed-phase columns separate creatine from creatinine and related guanidino compounds. Nitrogen content can be checked by Kjeldahl or combustion methods, while moisture is measured by Karl Fischer titration or loss on drying. These techniques give complementary views: chromatographic purity addresses related substances, whereas moisture and elemental data confirm hydrate stoichiometry. No single test defines quality by itself; a combination is used in specifications.
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Creatine monohydrate is one of several solid forms of creatine described in the literature. Other forms include anhydrous creatine, creatine hydrochloride, and creatine ethyl ester, each with different solubility and stability characteristics. The monohydrate is distinct from creatinine, a spontaneous breakdown compound that forms when creatine loses water and cyclizes. Commercial descriptions sometimes use synonyms such as methylguanidoacetic acid or N-(aminoiminomethyl)-N-methylglycine, which refer to the same base molecule. These names appear in chemical databases and product labels.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine binds with one molecule of water. Creatine itself is a nitrogen-containing organic acid involved in cellular energy transfer, particularly in muscle and nerve tissue. The monohydrate form is the most common solid form used in research and commercial products because it is relatively stable and easy to handle. Its molecular formula is C4H9N3O2·H2O, and its molar mass is about 149.15 grams per mole.
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
==== MeSH D13.695.462 – nucleotides, cyclic ==== MeSH D13.695.462.200 – cyclic amp MeSH D13.695.462.200.225 – 8-bromo cyclic adenosine monophosphate MeSH D13.695.462.200.250 – bucladesine MeSH D13.695.462.250 – cyclic cmp MeSH D13.695.462.275 – cyclic gmp MeSH D13.695.462.275.325 – dibutyryl cyclic gmp MeSH D13.695.462.300 – cyclic imp
Human serum albumin is the main protein of human blood plasma. It makes up around 50% of human plasma proteins. It binds water, cations (such as Ca2+, Na+ and K+), fatty acids, hormones, bilirubin, thyroxine (T4) and pharmaceuticals (including barbiturates). Its main function is to regulate the oncotic pressure of blood. The isoelectric point of albumin is 4.7. Alpha-fetoprotein is a fetal plasma protein that binds various cations, fatty acids and bilirubin. Vitamin D-binding protein binds to vitamin D and its metabolites, as well as to fatty acids. Afamin binds vitamin E. It seems to carry lipidated Wnt proteins and Vitamin E around. Extracellular matrix protein 1 is a less canonical albumin. It regulates bone mineralization. The four canonical human albumins are arranged on chromosome 4 region 4q13.3 in a tandem manner.
=== Integration of AMPK and ACC in the glucose-fatty acid cycle === Inhibition of fatty acid oxidation requires that ACC is active. Both AMPK and MCD are inactive and glucose uptake is stimulated. The LCFAs are then rerouted to esterification. These conditions exist in tissues rich in oxygen, in which AMPK is inactive and glucose inactivates the AMPK (researched in skeletal muscle). The inhibition of MCD suppresses the oxidation of fatty acids and stimulates glucose oxidation. In a study on MCD deficient mice there was no difference in the oxidation of fatty acids and glucose in the heart under aerobic conditions. It is theorized that the overexpression of fatty acids being used makes up for the lack of MCD.
Sources: en.wikipedia.org
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
isochromosome A type of abnormal chromosome in which the arms of the chromosome are mirror images of each other. Isochromosome formation is equivalent to simultaneous duplication and deletion events such that two copies of either the long arm or the short arm comprise the resulting chromosome.
Homology modeling is based on the reasonable assumption that two homologous proteins will share very similar structures. Because a protein's fold is more evolutionarily conserved than its amino acid sequence, a target sequence can be modeled with reasonable accuracy on a very distantly related template, provided that the relationship between target and template can be discerned through sequence alignment. It has been suggested that the primary bottleneck in comparative modelling arises from difficulties in alignment rather than from errors in structure prediction given a known-good alignment. Unsurprisingly, homology modelling is most accurate when the target and template have similar sequences. Protein threading scans the amino acid sequence of an unknown structure against a database of solved structures. In each case, a scoring function is used to assess the compatibility of the sequence to the structure, thus yielding possible three-dimensional models. This type of method is also known as 3D-1D fold recognition due to its compatibility analysis between three-dimensional structures and linear protein sequences. This method has also given rise to methods performing an inverse folding search by evaluating the compatibility of a given structure with a large database of sequences, thus predicting which sequences have the potential to produce a given fold.
=== Reading room === The original Reading Room was founded in August 1935 to entertain unemployed workers during the Great Depression. Started as an initiative by the New York Public Library, the Reading Room provided the jobless with a place to interact and share ideas without having to pay money or show identification. Despite this, the library was well-used, being used by 50,000 people by its first anniversary. Theft was low, with only 34 publications being lost in the library's first year. By its third year, 400 books and 1,000 magazines were in circulation and were being perused by 70,000 people per year. Books from the NYPL, and donations of magazines and trade publications from publishers, contributed to the success of the open-air library. The tradition of Reading Rooms halted in 1944 due to a staff shortage during World War II. The Reading Room tradition was revived in 2003 with HSBC as its first sponsor. Oxford University Press, Scholastic Corporation, Mitchell's NY, Condé Nast Publications, Time Inc., Hachette Filipacchi Media U.S., and Rodale, Inc. were among the companies who donated books and publications. In addition to the complimentary reading materials, in 2004 programming was added to Reading Room's content. The Reading Room features readings and book sales by contemporary writers and poets, plus book-related special events such as book clubs, writers workshops and storytelling for kids.
Sources: en.wikipedia.org
Purity is commonly assessed by HPLC, which separates creatine from related compounds such as creatinine. Water content is measured separately by Karl Fischer titration. Together these results help calculate the actual creatine content in a sample.
Creatine monohydrate contains water as part of its crystal structure, so some water is expected. Excess moisture can promote clumping, hydrolysis, or microbial growth. Karl Fischer titration measures total water and helps distinguish expected hydration from residual moisture.
Dicyandiamide, creatinine, and related nitrogenous compounds are common markers. Their levels are controlled by manufacturing processes and product specifications. Heavy metals and microbial limits may also be tested depending on the intended grade.
It is the hydrated crystalline form of creatine, containing one bound water molecule per creatine unit. The compound is commonly used as a nutritional ingredient and as a research material.